PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.09G136200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family WOX
Protein Properties Length: 260aa    MW: 28132.3 Da    PI: 6.1602
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.09G136200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.61.4e-152484257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         r+R+++++eq+ +Le+ F++   +p ++e  ++ k l    ++ +++V++WFqNrR + ++
  Manes.09G136200.1.p 24 RPRWNPKPEQILILESIFNSgMVNPPKDETVRIRKLLekfgSVVDANVFYWFQNRRSRSRR 84
                         89*****************99*************************************997 PP

2Wus_type_Homeobox105.14.4e-342486365
    Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                         r+RW+P+peQi iLe++++sG+++P+k+e+ ri++ Le++G + d+NVfyWFQNr++R+r+++
  Manes.09G136200.1.p 24 RPRWNPKPEQILILESIFNSGMVNPPKDETVRIRKLLEKFGSVVDANVFYWFQNRRSRSRRRH 86
                         79**********************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.112085IPR001356Homeobox domain
SuperFamilySSF466894.71E-132091IPR009057Homeodomain-like
SMARTSM003891.6E-72289IPR001356Homeobox domain
PfamPF000463.3E-132484IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-82492IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MEHNQGQDAN SRGNHGTERI EPMRPRWNPK PEQILILESI FNSGMVNPPK DETVRIRKLL  60
EKFGSVVDAN VFYWFQNRRS RSRRRHRQMQ ASLAEEKRNK RAQASGGAIH YEGGSGAGGS  120
SSSTSLMGFA NSPSLTVSPS YLLGSSSSVG VGGHEDGAVE SLFLPNEMGF QELDQGSDIS  180
SILCPSGSSN LQYQTGFITV FINGVETEVP GGPIDMKALF GQDAVLIHSS GVAVPCNEFG  240
FLMESLQHGE SYFLVSSQT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00330DAPTransfer from AT3G03660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002525671.21e-115PREDICTED: WUSCHEL-related homeobox 11 isoform X1
RefseqXP_015578806.11e-115PREDICTED: WUSCHEL-related homeobox 11 isoform X1
SwissprotQ6X7J35e-70WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLB9SI521e-115B9SI52_RICCO; Protein WUSCHEL, putative
STRINGPOPTR_0013s06310.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58983152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.12e-33WUSCHEL related homeobox 11